CENPB antibody (70R-5526)

Rabbit polyclonal CENPB antibody raised against the C terminal of CENPB

Synonyms Polyclonal CENPB antibody, Anti-CENPB antibody, Centromere Protein B 80Kda antibody
Specificity CENPB antibody was raised against the C terminal of CENPB
Cross Reactivity Human
Applications WB
Immunogen CENPB antibody was raised using the C terminal of CENPB corresponding to a region with amino acids GGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVK
Assay Information CENPB Blocking Peptide, catalog no. 33R-3277, is also available for use as a blocking control in assays to test for specificity of this CENPB antibody


Western Blot analysis using CENPB antibody (70R-5526)

CENPB antibody (70R-5526) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CENPB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CENPB is a highly conserved protein that facilitates centromere formation. It is a DNA-binding protein that is derived from transposases of the pogo DNA transposon family. It contains a helix-loop-helix DNA binding motif at the N-terminus, and a dimerization domain at the C-terminus. This protein is proposed to play an important role in the assembly of specific centromere structures in interphase nuclei and on mitotic chromosomes. It is also considered a major centromere autoantigen recognised by sera from patients with anti-centromere antibodies.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CENPB antibody (70R-5526) | CENPB antibody (70R-5526) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors