CENPP antibody (70R-2175)

Rabbit polyclonal CENPP antibody raised against the N terminal of CENPP

Synonyms Polyclonal CENPP antibody, Anti-CENPP antibody, FLJ33928 antibody, CENP-P antibody, Centromere Protein P antibody
Specificity CENPP antibody was raised against the N terminal of CENPP
Cross Reactivity Human
Applications WB
Immunogen CENPP antibody was raised using the N terminal of CENPP corresponding to a region with amino acids VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ
Assay Information CENPP Blocking Peptide, catalog no. 33R-9748, is also available for use as a blocking control in assays to test for specificity of this CENPP antibody

Images

Western Blot analysis using CENPP antibody (70R-2175)

CENPP antibody (70R-2175) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CENPP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CENPP is the component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. CENPP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CENPP antibody (70R-2175) | CENPP antibody (70R-2175) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors