CENTB5 antibody (70R-4129)

Rabbit polyclonal CENTB5 antibody raised against the N terminal of CENTB5

Synonyms Polyclonal CENTB5 antibody, Anti-CENTB5 antibody, Centaurin Beta 5 antibody, KIAA1716 antibody
Specificity CENTB5 antibody was raised against the N terminal of CENTB5
Cross Reactivity Human,Mouse
Applications WB
Immunogen CENTB5 antibody was raised using the N terminal of CENTB5 corresponding to a region with amino acids LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA
Assay Information CENTB5 Blocking Peptide, catalog no. 33R-5340, is also available for use as a blocking control in assays to test for specificity of this CENTB5 antibody


Western Blot analysis using CENTB5 antibody (70R-4129)

CENTB5 antibody (70R-4129) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CENTB5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CENTB5 is a GTPase-activating protein for the ADP ribosylation factor family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CENTB5 antibody (70R-4129) | CENTB5 antibody (70R-4129) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors