CEP55 antibody (70R-2147)

Rabbit polyclonal CEP55 antibody raised against the middle region of CEP55

Synonyms Polyclonal CEP55 antibody, Anti-CEP55 antibody, C10orf3 antibody, FLJ10540 antibody, Centrosomal Protein 55Kda antibody, URCC6 antibody
Specificity CEP55 antibody was raised against the middle region of CEP55
Cross Reactivity Human
Applications WB
Immunogen CEP55 antibody was raised using the middle region of CEP55 corresponding to a region with amino acids TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL
Assay Information CEP55 Blocking Peptide, catalog no. 33R-9162, is also available for use as a blocking control in assays to test for specificity of this CEP55 antibody


Western Blot analysis using CEP55 antibody (70R-2147)

CEP55 antibody (70R-2147) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CEP55 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CEP55 antibody (70R-2147) | CEP55 antibody (70R-2147) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors