CETP antibody (70R-5415)

Rabbit polyclonal CETP antibody raised against the middle region of CETP

Synonyms Polyclonal CETP antibody, Anti-CETP antibody, Cholesteryl Ester Transfer Protein Plasma antibody
Specificity CETP antibody was raised against the middle region of CETP
Cross Reactivity Human
Applications WB
Immunogen CETP antibody was raised using the middle region of CETP corresponding to a region with amino acids KKLFLSLLDFQITPKTVSNLTESSSESVQSFLQSMITAVGIPEVMSRLEV
Assay Information CETP Blocking Peptide, catalog no. 33R-4481, is also available for use as a blocking control in assays to test for specificity of this CETP antibody

Images

Western Blot analysis using CETP antibody (70R-5415)

CETP antibody (70R-5415) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CETP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CETP involved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol. Defects in CETP are a cause of hyperalphalipoproteinemia. Cholesteryl ester transfer protein (CETP) transfers cholesteryl esters between lipoproteins. CETP may effect susceptibility to atherosclerosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CETP antibody (70R-5415) | CETP antibody (70R-5415) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors