CHCHD1 antibody (70R-4035)

Rabbit polyclonal CHCHD1 antibody raised against the middle region of CHCHD1

Synonyms Polyclonal CHCHD1 antibody, Anti-CHCHD1 antibody, C10orf34 antibody, Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1 antibody, FLJ25854 antibody, C2360 antibody
Specificity CHCHD1 antibody was raised against the middle region of CHCHD1
Cross Reactivity Human
Applications WB
Immunogen CHCHD1 antibody was raised using the middle region of CHCHD1 corresponding to a region with amino acids KEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYL
Assay Information CHCHD1 Blocking Peptide, catalog no. 33R-4338, is also available for use as a blocking control in assays to test for specificity of this CHCHD1 antibody


Western Blot analysis using CHCHD1 antibody (70R-4035)

CHCHD1 antibody (70R-4035) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHCHD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CHCHD protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHCHD1 antibody (70R-4035) | CHCHD1 antibody (70R-4035) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors