CHEK1 antibody (70R-5597)

Rabbit polyclonal CHEK1 antibody

Synonyms Polyclonal CHEK1 antibody, Anti-CHEK1 antibody, CHEK-1 antibody, CHK1 antibody, Chk1 Checkpoint Homolog antibody, CHEK 1, CHEK 1 antibody, CHEK-1, CHEK1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CHEK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
Assay Information CHEK1 Blocking Peptide, catalog no. 33R-8312, is also available for use as a blocking control in assays to test for specificity of this CHEK1 antibody


Western Blot analysis using CHEK1 antibody (70R-5597)

CHEK1 antibody (70R-5597) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHEK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHEK1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage. Its expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHEK1 antibody (70R-5597) | CHEK1 antibody (70R-5597) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors