CHFR antibody (70R-2072)

Rabbit polyclonal CHFR antibody raised against the N terminal of CHFR

Synonyms Polyclonal CHFR antibody, Anti-CHFR antibody, FLJ33629 antibody, FLJ10796 antibody, Checkpoint With Forkhead And Ring Finger Domains antibody, RNF196 antibody, RNF116 antibody
Specificity CHFR antibody was raised against the N terminal of CHFR
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CHFR antibody was raised using the N terminal of CHFR corresponding to a region with amino acids REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN
Assay Information CHFR Blocking Peptide, catalog no. 33R-7895, is also available for use as a blocking control in assays to test for specificity of this CHFR antibody


Western blot analysis using CHFR antibody (70R-2072)

Recommended CHFR Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHFR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHFR is an E3 ubiquitin-protein ligase required to transiently arrest cells in early prophase when they are exposed to microtubule poisons. It acts in early prophase before chromosome condensation, when the centrosome moves apart from each other along the periphery of the nucleus. CHFR probably promotes the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating UBC13-MMS2 (UBE2N-UBE2V2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress. This suggests that it may be involved in signaling the presence of mitotic stress caused by microtubule poisons.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using CHFR antibody (70R-2072) | Recommended CHFR Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using CHFR antibody (70R-2072) | Breast

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors