CHRNA1 antibody (70R-4601)

Rabbit polyclonal CHRNA1 antibody

Synonyms Polyclonal CHRNA1 antibody, Anti-CHRNA1 antibody, Cholinergic Receptor Nicotinic Alpha 1 antibody
Cross Reactivity Human
Applications WB
Immunogen CHRNA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNV
Assay Information CHRNA1 Blocking Peptide, catalog no. 33R-9265, is also available for use as a blocking control in assays to test for specificity of this CHRNA1 antibody


Western Blot analysis using CHRNA1 antibody (70R-4601)

CHRNA1 antibody (70R-4601) used at 1.8 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHRNA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 CHRNA1 encodes an alpha subunit that plays a role in acetlycholine binding/channel gating.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHRNA1 antibody (70R-4601) | CHRNA1 antibody (70R-4601) used at 1.8 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors