CHRNA3 antibody (70R-5188)

Rabbit polyclonal CHRNA3 antibody raised against the N terminal of CHRNA3

Synonyms Polyclonal CHRNA3 antibody, Anti-CHRNA3 antibody, MGC104879 antibody, Cholinergic Receptor Nicotinic Alpha 3 antibody
Specificity CHRNA3 antibody was raised against the N terminal of CHRNA3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CHRNA3 antibody was raised using the N terminal of CHRNA3 corresponding to a region with amino acids EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN
Assay Information CHRNA3 Blocking Peptide, catalog no. 33R-2458, is also available for use as a blocking control in assays to test for specificity of this CHRNA3 antibody

Images

Western blot analysis using CHRNA3 antibody (70R-5188)

Recommended CHRNA3 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHRNA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using CHRNA3 antibody (70R-5188) | Recommended CHRNA3 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £272.51
Size: 50 ug
OR
Shipping
View Our Distributors