Chromogranin A antibody (70R-5338)

Rabbit polyclonal Chromogranin A antibody

Synonyms Polyclonal Chromogranin A antibody, Anti-Chromogranin A antibody, Parathyroid Secretory Protein 1 antibody, CHGA antibody, CGA antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Chromogranin A antibody was raised using a synthetic peptide corresponding to a region with amino acids DSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ
Assay Information Chromogranin A Blocking Peptide, catalog no. 33R-2167, is also available for use as a blocking control in assays to test for specificity of this Chromogranin A antibody


Western Blot analysis using Chromogranin A antibody (70R-5338)

Chromogranin A antibody (70R-5338) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHGA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHGA is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. Its gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Chromogranin A antibody (70R-5338) | Chromogranin A antibody (70R-5338) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
View Our Distributors