CHST1 antibody (70R-1892)

Rabbit polyclonal CHST1 antibody

Synonyms Polyclonal CHST1 antibody, Anti-CHST1 antibody, C6ST antibody, KSGal6ST antibody, Carbohydrate antibody, KS6ST antibody, Keratan Sulfate Gal-6 Sulfotransferase 1 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL
Assay Information CHST1 Blocking Peptide, catalog no. 33R-8443, is also available for use as a blocking control in assays to test for specificity of this CHST1 antibody


Immunohistochemical staining using CHST1 antibody (70R-1892)

CHST1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CHST1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc structures is much higher than the corresponding desialylated substrate, and only internal Gal residues are sulfated. It may function in the sulfation of sialyl N-acetyllactosamine oligosaccharide chains attached to glycoproteins. It participates in biosynthesis of selectin ligands. Selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using CHST1 antibody (70R-1892) | CHST1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using CHST1 antibody (70R-1892) | CHST1 antibody (70R-1892) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using CHST1 antibody (70R-1892) | CHST1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors