CHST7 antibody (70R-1906)

Rabbit polyclonal CHST7 antibody

Synonyms Polyclonal CHST7 antibody, Anti-CHST7 antibody, N-Acetylglucosamine 6-O Sulfotransferase 7 antibody, C6ST-2 antibody, Carbohydrate antibody
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen CHST7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR
Assay Information CHST7 Blocking Peptide, catalog no. 33R-2045, is also available for use as a blocking control in assays to test for specificity of this CHST7 antibody

Images

Western Blot analysis using CHST7 antibody (70R-1906)

CHST7 antibody (70R-1906) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CHST7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHST7 belongs to the sulfotransferase family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This protein mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of the family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHST7 antibody (70R-1906) | CHST7 antibody (70R-1906) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors