CHTF18 antibody (70R-3758)

Rabbit polyclonal CHTF18 antibody

Synonyms Polyclonal CHTF18 antibody, Anti-CHTF18 antibody, C321D2.3 antibody, C321D2.4 antibody, Ctf18 Chromosome Transmission Fidelity Factor 18 Homolog antibody, CHL12 antibody, C16orf41 antibody, Ctf18 antibody, C321D2.2 antibody, RUVBL antibody
Cross Reactivity Human
Applications WB
Immunogen CHTF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLLDALCLLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYR
Assay Information CHTF18 Blocking Peptide, catalog no. 33R-7466, is also available for use as a blocking control in assays to test for specificity of this CHTF18 antibody

Images

Western Blot analysis using CHTF18 antibody (70R-3758)

CHTF18 antibody (70R-3758) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 107 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHTF18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHTF18, CHTF8, and DCC1 are components of an alternative replication factor C (RFC) complex that loads PCNA onto DNA during S phase of the cell cycle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHTF18 antibody (70R-3758) | CHTF18 antibody (70R-3758) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors