Chymotrypsin-Like antibody (70R-5490)

Rabbit polyclonal Chymotrypsin-Like antibody raised against the N terminal of CTRL

Synonyms Polyclonal Chymotrypsin-Like antibody, Anti-Chymotrypsin-Like antibody, MGC70821 antibody, CTRL antibody, CTRL1 antibody
Specificity Chymotrypsin-Like antibody was raised against the N terminal of CTRL
Cross Reactivity Human
Applications WB
Immunogen Chymotrypsin-Like antibody was raised using the N terminal of CTRL corresponding to a region with amino acids LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL
Assay Information Chymotrypsin-Like Blocking Peptide, catalog no. 33R-5164, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsin-Like antibody


Western Blot analysis using Chymotrypsin-Like antibody (70R-5490)

Chymotrypsin-Like antibody (70R-5490) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CTRL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CTRL contains 1 F-box domain. It is substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Chymotrypsin-Like antibody (70R-5490) | Chymotrypsin-Like antibody (70R-5490) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors