CIRBP antibody (70R-5012)

Rabbit polyclonal CIRBP antibody raised against the N terminal of CIRBP

Synonyms Polyclonal CIRBP antibody, Anti-CIRBP antibody, CIRP antibody, Cold Inducible Rna Binding Protein antibody
Specificity CIRBP antibody was raised against the N terminal of CIRBP
Cross Reactivity Human
Applications WB
Immunogen CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG
Assay Information CIRBP Blocking Peptide, catalog no. 33R-5739, is also available for use as a blocking control in assays to test for specificity of this CIRBP antibody


Western Blot analysis using CIRBP antibody (70R-5012)

CIRBP antibody (70R-5012) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CIRBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CIRBP contains 1 RRM (RNA recognition motif) domain. It seems to play an essential role in cold-induced suppression of cell proliferation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CIRBP antibody (70R-5012) | CIRBP antibody (70R-5012) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors