CK1 alpha 1 antibody (70R-3672)

Rabbit polyclonal CK1 alpha 1 antibody raised against the C terminal of CSNK1A1

Synonyms Polyclonal CK1 alpha 1 antibody, Anti-CK1 alpha 1 antibody, CK1, CK-1, PRO2975 antibody, CK-1 antibody, HLCDGP1 antibody, CK1 antibody, CK 1, Casein Kinase 1 Alpha 1 antibody, CSNK1A1 antibody, CK 1 antibody
Specificity CK1 alpha 1 antibody was raised against the C terminal of CSNK1A1
Cross Reactivity Human
Applications WB
Immunogen CK1 alpha 1 antibody was raised using the C terminal of CSNK1A1 corresponding to a region with amino acids HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
Assay Information CK1 alpha 1 Blocking Peptide, catalog no. 33R-3833, is also available for use as a blocking control in assays to test for specificity of this CK1 alpha 1 antibody


Western Blot analysis using CK1 alpha 1 antibody (70R-3672)

CK1 alpha 1 antibody (70R-3672) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSNK1A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSNK1A1 belongs to the protein kinase superfamily. The function of the CSNK1A1 protein is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CK1 alpha 1 antibody (70R-3672) | CK1 alpha 1 antibody (70R-3672) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors