CK1 epsilon antibody (70R-2068)

Rabbit polyclonal CK1 epsilon antibody raised against the N terminal of CSNK1E

Synonyms Polyclonal CK1 epsilon antibody, Anti-CK1 epsilon antibody, CK1D antibody, Casein Kinase 1 Epsilon antibody, CK-1, CK-1 antibody, CK 1 antibody, CK1, HCKIE antibody, CK 1, MGC10398 antibody, CSNK1E antibody
Specificity CK1 epsilon antibody was raised against the N terminal of CSNK1E
Cross Reactivity Human, Mouse, Rat, Drosophila
Applications WB
Immunogen CK1 epsilon antibody was raised using the N terminal of CSNK1E corresponding to a region with amino acids MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH
Assay Information CK1 epsilon Blocking Peptide, catalog no. 33R-5936, is also available for use as a blocking control in assays to test for specificity of this CK1 epsilon antibody

Images

Western Blot analysis using CK1 epsilon antibody (70R-2068)

CK1 epsilon antibody (70R-2068) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSNK1E antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1E can phosphorylate a large number of proteins. CSNK1E participates in Wnt signaling and is the central component of the circadian clock. It may act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. CSNK1E inhibits cytokine-induced granuloytic differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CK1 epsilon antibody (70R-2068) | CK1 epsilon antibody (70R-2068) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors