CKMM antibody (70R-1985)

Rabbit polyclonal CKMM antibody raised against the middle region of CKM

Synonyms Polyclonal CKMM antibody, Anti-CKMM antibody, Creatine Kinase Muscle antibody, Creatine Kinase MM Isoenzyme antibody, M-CK antibody, CK MM antibody
Specificity CKMM antibody was raised against the middle region of CKM
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen CKMM antibody was raised using the middle region of CKM corresponding to a region with amino acids GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI
Assay Information CKMM Blocking Peptide, catalog no. 33R-3630, is also available for use as a blocking control in assays to test for specificity of this CKMM antibody


Western Blot analysis using CKMM antibody (70R-1985)

CKMM antibody (70R-1985) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CKM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. CKM is a member of the ATP: guanido phosphotransferase protein family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CKMM antibody (70R-1985) | CKMM antibody (70R-1985) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors