Claudin 10 antibody (70R-1691)

Rabbit polyclonal Claudin 10 antibody raised against the C terminal of CLDN10

Synonyms Polyclonal Claudin 10 antibody, Anti-Claudin 10 antibody, Claudin 10, CLDN10 antibody, Claudin 10 antibody, Claudin -10, Claudin -10 antibody, Claudin 10
Specificity Claudin 10 antibody was raised against the C terminal of CLDN10
Cross Reactivity Human
Applications WB
Immunogen Claudin 10 antibody was raised using the C terminal of CLDN10 corresponding to a region with amino acids MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLW
Assay Information Claudin 10 Blocking Peptide, catalog no. 33R-5765, is also available for use as a blocking control in assays to test for specificity of this Claudin 10 antibody


Western Blot analysis using Claudin 10 antibody (70R-1691)

Claudin 10 antibody (70R-1691) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLDN10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLDN10 encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Claudin 10 antibody (70R-1691) | Claudin 10 antibody (70R-1691) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors