Claudin 15 antibody (70R-1688)

Rabbit polyclonal Claudin 15 antibody raised against the C terminal of CLDN15

Synonyms Polyclonal Claudin 15 antibody, Anti-Claudin 15 antibody, Claudin 15, Claudin -15 antibody, CLDN15 antibody, Claudin 15, Claudin -15, Claudin 15 antibody
Specificity Claudin 15 antibody was raised against the C terminal of CLDN15
Cross Reactivity Human
Applications WB
Immunogen Claudin 15 antibody was raised using the C terminal of CLDN15 corresponding to a region with amino acids LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
Assay Information Claudin 15 Blocking Peptide, catalog no. 33R-4831, is also available for use as a blocking control in assays to test for specificity of this Claudin 15 antibody


Western Blot analysis using Claudin 15 antibody (70R-1688)

Claudin 15 antibody (70R-1688) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLDN15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Claudin 15 antibody (70R-1688) | Claudin 15 antibody (70R-1688) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors