Claudin 17 antibody (70R-1693)

Rabbit polyclonal Claudin 17 antibody raised against the middle region of CLDN17

Synonyms Polyclonal Claudin 17 antibody, Anti-Claudin 17 antibody, Claudin 17, Claudin 17, Claudin -17, CLDN17 antibody, Claudin 17 antibody, Claudin -17 antibody
Specificity Claudin 17 antibody was raised against the middle region of CLDN17
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
Assay Information Claudin 17 Blocking Peptide, catalog no. 33R-4616, is also available for use as a blocking control in assays to test for specificity of this Claudin 17 antibody


Immunohistochemical staining using Claudin 17 antibody (70R-1693)

Claudin 17 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Spleen cells (arrows) in Human Spleen. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLDN17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Claudin 17 antibody (70R-1693) | Claudin 17 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Spleen cells (arrows) in Human Spleen. Magnification is at 400X.
  • Western Blot analysis using Claudin 17 antibody (70R-1693) | Claudin 17 antibody (70R-1693) used at 2 ug/ml to detect target protein.
  • Immunohistochemical staining using Claudin 17 antibody (70R-1693) | Claudin 17 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X

Availability: In stock

Price: £228.91
Size: 100 ug
View Our Distributors