Claudin 9 antibody (70R-1694)

Rabbit polyclonal Claudin 9 antibody raised against the C terminal of CLDN9

Synonyms Polyclonal Claudin 9 antibody, Anti-Claudin 9 antibody, Claudin -9 antibody, Claudin 9, Claudin 9, CLDN9 antibody, Claudin -9, Claudin 9 antibody
Specificity Claudin 9 antibody was raised against the C terminal of CLDN9
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen Claudin 9 antibody was raised using the C terminal of CLDN9 corresponding to a region with amino acids WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
Assay Information Claudin 9 Blocking Peptide, catalog no. 33R-9930, is also available for use as a blocking control in assays to test for specificity of this Claudin 9 antibody


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLDN9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors