CLCN3 antibody (70R-1484)

Rabbit polyclonal CLCN3 antibody raised against the C terminal of CLCN3

Synonyms Polyclonal CLCN3 antibody, Anti-CLCN3 antibody, Chloride Channel 3 antibody
Specificity CLCN3 antibody was raised against the C terminal of CLCN3
Cross Reactivity Human
Applications IHC, WB
Immunogen CLCN3 antibody was raised using the C terminal of CLCN3 corresponding to a region with amino acids MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGD
Assay Information CLCN3 Blocking Peptide, catalog no. 33R-5956, is also available for use as a blocking control in assays to test for specificity of this CLCN3 antibody

Images

Immunohistochemical staining using CLCN3 antibody (70R-1484)

CLCN3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 95 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLCN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using CLCN3 antibody (70R-1484) | CLCN3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X
  • Western Blot analysis using CLCN3 antibody (70R-1484) | CLCN3 antibody (70R-1484) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors