CLCNKA antibody (70R-5151)

Rabbit polyclonal CLCNKA antibody raised against the N terminal of CLCNKA

Synonyms Polyclonal CLCNKA antibody, Anti-CLCNKA antibody, CLCK1 antibody, MGC61490 antibody, ClC-K1 antibody, Chloride Channel Ka antibody, hClC-Ka antibody
Specificity CLCNKA antibody was raised against the N terminal of CLCNKA
Cross Reactivity Human
Applications WB
Immunogen CLCNKA antibody was raised using the N terminal of CLCNKA corresponding to a region with amino acids MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW
Assay Information CLCNKA Blocking Peptide, catalog no. 33R-5907, is also available for use as a blocking control in assays to test for specificity of this CLCNKA antibody

Images

Western Blot analysis using CLCNKA antibody (70R-5151)

CLCNKA antibody (70R-5151) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLCNKA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLCNKA is a member of the CLC family of voltage-gated chloride channels. It is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. This gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CLCNKA antibody (70R-5151) | CLCNKA antibody (70R-5151) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors