CLCNKB antibody (70R-5058)

Rabbit polyclonal CLCNKB antibody raised against the N terminal of CLCNKB

Synonyms Polyclonal CLCNKB antibody, Anti-CLCNKB antibody, hClC-Kb antibody, Chloride Channel Kb antibody, ClC-K2 antibody, RP11-5P18.8 antibody, MGC24087 antibody, CLCKB antibody
Specificity CLCNKB antibody was raised against the N terminal of CLCNKB
Cross Reactivity Human
Applications WB
Immunogen CLCNKB antibody was raised using the N terminal of CLCNKB corresponding to a region with amino acids MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDW
Assay Information CLCNKB Blocking Peptide, catalog no. 33R-5901, is also available for use as a blocking control in assays to test for specificity of this CLCNKB antibody

Images

Western Blot analysis using CLCNKB antibody (70R-5058)

CLCNKB antibody (70R-5058) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLCNKB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Chloride channel Kb (CLCNKB) is a member of the CLC family of voltage-gated chloride channels, which comprises at least 9 mammalian chloride channels. Each is believed to have 12 transmembrane domains and intracellular N and C termini. Mutations in CLCNKB result in the autosomal recessive Type III Bartter Syndrome. CLCNKA and CLCNKB are closely related (94% sequence identity), tightly linked (separated by 11 kb of genomic sequence) and are both expressed in mammalian kidney.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CLCNKB antibody (70R-5058) | CLCNKB antibody (70R-5058) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors