CLEC4M antibody (70R-1704)

Rabbit polyclonal CLEC4M antibody raised against the N terminal of CLEC4M

Synonyms Polyclonal CLEC4M antibody, Anti-CLEC4M antibody, DC-SIGN2 antibody, DCSIGNR antibody, HP10347 antibody, L-SIGN antibody, C-Type Lectin Domain Family 4 Member M antibody, MGC129964 antibody, MGC47866 antibody, DC-SIGNR antibody, LSIGN antibody, CD299 antibody, CD209L antibody
Specificity CLEC4M antibody was raised against the N terminal of CLEC4M
Cross Reactivity Human
Applications IHC, WB
Immunogen CLEC4M antibody was raised using the N terminal of CLEC4M corresponding to a region with amino acids LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV
Assay Information CLEC4M Blocking Peptide, catalog no. 33R-5525, is also available for use as a blocking control in assays to test for specificity of this CLEC4M antibody


Immunohistochemical staining using CLEC4M antibody (70R-1704)

CLEC4M antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLEC4M antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLEC4M is a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using CLEC4M antibody (70R-1704) | CLEC4M antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using CLEC4M antibody (70R-1704) | CLEC4M antibody (70R-1704) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors