Complexin 2 antibody (70R-4500)

Rabbit polyclonal Complexin 2 antibody raised against the N terminal of CPLX2

Synonyms Polyclonal Complexin 2 antibody, Anti-Complexin 2 antibody, CPX-2 antibody, MGC138492 antibody, 921-L antibody, Complexin 2, Complexin 2 antibody, Hfb1 antibody, Complexin -2, Complexin 2, Complexin -2 antibody, CPLX2 antibody, CPX2 antibody
Specificity Complexin 2 antibody was raised against the N terminal of CPLX2
Cross Reactivity Human
Applications WB
Immunogen Complexin 2 antibody was raised using the N terminal of CPLX2 corresponding to a region with amino acids MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA
Assay Information Complexin 2 Blocking Peptide, catalog no. 33R-5832, is also available for use as a blocking control in assays to test for specificity of this Complexin 2 antibody

Images

Immunohistochemical staining using Complexin 2 antibody (70R-4500)

Complexin 2 in human hippocampus was delected using HRP/AEC red color stain.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPLX2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Complexin 2 antibody (70R-4500) | Complexin 2 in human hippocampus was delected using HRP/AEC red color stain.
  • Western Blot analysis using Complexin 2 antibody (70R-4500) | Complexin 2 antibody (70R-4500) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors