COPG antibody (70R-3810)

Rabbit polyclonal COPG antibody raised against the N terminal of COPG

Synonyms Polyclonal COPG antibody, Anti-COPG antibody, Coatomer Protein Complex Subunit Gamma antibody, FLJ21068 antibody, COPG1 antibody
Specificity COPG antibody was raised against the N terminal of COPG
Cross Reactivity Human
Applications WB
Immunogen COPG antibody was raised using the N terminal of COPG corresponding to a region with amino acids MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK
Assay Information COPG Blocking Peptide, catalog no. 33R-6190, is also available for use as a blocking control in assays to test for specificity of this COPG antibody

Images

Western Blot analysis using COPG antibody (70R-3810)

COPG antibody (70R-3810) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COPG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using COPG antibody (70R-3810) | COPG antibody (70R-3810) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors