COPG2 antibody (70R-3831)

Rabbit polyclonal COPG2 antibody raised against the N terminal of COPG2

Synonyms Polyclonal COPG2 antibody, Anti-COPG2 antibody, Coatomer Protein Complex Subunit Gamma 2 antibody, 2-COP antibody, FLJ11781 antibody
Specificity COPG2 antibody was raised against the N terminal of COPG2
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen COPG2 antibody was raised using the N terminal of COPG2 corresponding to a region with amino acids MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK
Assay Information COPG2 Blocking Peptide, catalog no. 33R-6111, is also available for use as a blocking control in assays to test for specificity of this COPG2 antibody

Images

Western Blot analysis using COPG2 antibody (70R-3831)

COPG2 antibody (70R-3831) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COPG2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using COPG2 antibody (70R-3831) | COPG2 antibody (70R-3831) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors