Copine IV antibody (70R-2258)

Rabbit polyclonal Copine IV antibody raised against the C terminal of CPNE4

Synonyms Polyclonal Copine IV antibody, Anti-Copine IV antibody, MGC15604 antibody, CPNE4 antibody, COPN4 antibody, CPN4 antibody, Copine 4 antibody
Specificity Copine IV antibody was raised against the C terminal of CPNE4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Copine IV antibody was raised using the C terminal of CPNE4 corresponding to a region with amino acids EAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDG
Assay Information Copine IV Blocking Peptide, catalog no. 33R-2291, is also available for use as a blocking control in assays to test for specificity of this Copine IV antibody


Western Blot analysis using Copine IV antibody (70R-2258)

Copine IV antibody (70R-2258) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPNE4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Copine IV antibody (70R-2258) | Copine IV antibody (70R-2258) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors