CPEB2 antibody (70R-4851)

Rabbit polyclonal CPEB2 antibody raised against the N terminal of CPEB2

Synonyms Polyclonal CPEB2 antibody, Anti-CPEB2 antibody, Cytoplasmic Polyadenylation Element Binding Protein 2 antibody
Specificity CPEB2 antibody was raised against the N terminal of CPEB2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CPEB2 antibody was raised using the N terminal of CPEB2 corresponding to a region with amino acids FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG
Assay Information CPEB2 Blocking Peptide, catalog no. 33R-2978, is also available for use as a blocking control in assays to test for specificity of this CPEB2 antibody


Western Blot analysis using CPEB2 antibody (70R-4851)

CPEB2 antibody (70R-4851) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPEB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CPEB2 antibody (70R-4851) | CPEB2 antibody (70R-4851) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors