CPS1 antibody (70R-1112)

Rabbit polyclonal CPS1 antibody raised against the middle region of CPS1

Synonyms Polyclonal CPS1 antibody, Anti-CPS1 antibody, Carbamoyl-Phosphate Synthetase 1 Mitochondrial antibody
Specificity CPS1 antibody was raised against the middle region of CPS1
Cross Reactivity Human
Applications IHC, WB
Immunogen CPS1 antibody was raised using the middle region of CPS1 corresponding to a region with amino acids YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI
Assay Information CPS1 Blocking Peptide, catalog no. 33R-10208, is also available for use as a blocking control in assays to test for specificity of this CPS1 antibody


Immunohistochemical staining using CPS1 antibody (70R-1112)

CPS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 165 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CPS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Carbamoyl phosphate synthetase I is the rate-limiting enzyme that catalyzes the first committed step of the hepatic urea cycle. The mitochondrial isozyme is designated CPS I and the cytoplasmic enzyme CPS II. CPS II is part of a multifunctional enzyme, called the CAD trifunctional protein of pyrimidine biosynthesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using CPS1 antibody (70R-1112) | CPS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using CPS1 antibody (70R-1112) | CPS1 antibody (70R-1112) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using CPS1 antibody (70R-1112) | CPS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors