CPSF3 antibody (70R-1351)

Rabbit polyclonal CPSF3 antibody raised against the C terminal of CPSF3

Synonyms Polyclonal CPSF3 antibody, Anti-CPSF3 antibody, Cleavage And Polyadenylation Specific Factor 3 73Kda antibody
Specificity CPSF3 antibody was raised against the C terminal of CPSF3
Cross Reactivity Human
Applications IHC, WB
Immunogen CPSF3 antibody was raised using the C terminal of CPSF3 corresponding to a region with amino acids DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEAL
Assay Information CPSF3 Blocking Peptide, catalog no. 33R-1889, is also available for use as a blocking control in assays to test for specificity of this CPSF3 antibody


Immunohistochemical staining using CPSF3 antibody (70R-1351)

CPSF3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Liver cell (arrows) in Human Liver. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CPSF3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CPSF3 belongs to the RNA-metabolizing metallo-beta-lactamase-like family, CPSF3 subfamily. It is component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using CPSF3 antibody (70R-1351) | CPSF3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Liver cell (arrows) in Human Liver. Magnification is at 400X
  • Western Blot analysis using CPSF3 antibody (70R-1351) | CPSF3 antibody (70R-1351) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors