CPSF4 antibody (70R-4619)

Rabbit polyclonal CPSF4 antibody raised against the C terminal of CPSF4

Synonyms Polyclonal CPSF4 antibody, Anti-CPSF4 antibody, CPSF30 antibody, NAR antibody, NEB1 antibody, Cleavage And Polyadenylation Specific Factor 4 30Kda antibody
Specificity CPSF4 antibody was raised against the C terminal of CPSF4
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen CPSF4 antibody was raised using the C terminal of CPSF4 corresponding to a region with amino acids SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK
Assay Information CPSF4 Blocking Peptide, catalog no. 33R-8599, is also available for use as a blocking control in assays to test for specificity of this CPSF4 antibody

Images

Western Blot analysis using CPSF4 antibody (70R-4619)

CPSF4 antibody (70R-4619) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPSF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30 kDa subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CPSF4 antibody (70R-4619) | CPSF4 antibody (70R-4619) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors