CRELD1 antibody (70R-1808)

Rabbit polyclonal CRELD1 antibody raised against the C terminal of CRELD1

Synonyms Polyclonal CRELD1 antibody, Anti-CRELD1 antibody, DKFZP566D213 antibody, Cysteine-Rich With Egf-Like Domains 1 antibody, AVSD2 antibody, CIRRIN antibody
Specificity CRELD1 antibody was raised against the C terminal of CRELD1
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE
Assay Information CRELD1 Blocking Peptide, catalog no. 33R-9056, is also available for use as a blocking control in assays to test for specificity of this CRELD1 antibody


Western Blot analysis using CRELD1 antibody (70R-1808)

CRELD1 antibody (70R-1808) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CRELD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Epidermal growth factor like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CRELD1 antibody (70R-1808) | CRELD1 antibody (70R-1808) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using CRELD1 antibody (70R-1808) | CRELD1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors