CRISP1 antibody (70R-5306)

Rabbit polyclonal CRISP1 antibody raised against the N terminal of CRISP1

Synonyms Polyclonal CRISP1 antibody, Anti-CRISP1 antibody, Cysteine-Rich Secretory Protein 1 antibody, CRISP-1 antibody, HUMARP antibody, HSCRISP1G antibody, AEGL1 antibody, HSCRISP1D antibody, ARP antibody
Specificity CRISP1 antibody was raised against the N terminal of CRISP1
Cross Reactivity Human
Applications WB
Immunogen CRISP1 antibody was raised using the N terminal of CRISP1 corresponding to a region with amino acids LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW
Assay Information CRISP1 Blocking Peptide, catalog no. 33R-5093, is also available for use as a blocking control in assays to test for specificity of this CRISP1 antibody

Images

Western Blot analysis using CRISP1 antibody (70R-5306)

CRISP1 antibody (70R-5306) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRISP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. CRISP1 is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CRISP1 antibody (70R-5306) | CRISP1 antibody (70R-5306) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors