Crystallin Alpha B antibody (70R-1016)

Rabbit polyclonal Crystallin Alpha B antibody raised against the C terminal of CRYAB

Synonyms Polyclonal Crystallin Alpha B antibody, Anti-Crystallin Alpha B antibody, HSPB5 antibody, CRYAB antibody, CRYA2 antibody, CTPP2 antibody
Specificity Crystallin Alpha B antibody was raised against the C terminal of CRYAB
Cross Reactivity Human,Mouse
Applications WB
Immunogen Crystallin Alpha B antibody was raised using the C terminal of CRYAB corresponding to a region with amino acids KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT
Assay Information Crystallin Alpha B Blocking Peptide, catalog no. 33R-4750, is also available for use as a blocking control in assays to test for specificity of this Crystallin Alpha B antibody


Western Blot analysis using Crystallin Alpha B antibody (70R-1016)

Crystallin Alpha B antibody (70R-1016) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 12 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CRYAB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Alpha crystallins are composed of: alpha-A and alpha-B, for acidic and basic, respectively. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Crystallin Alpha B antibody (70R-1016) | Crystallin Alpha B antibody (70R-1016) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors