CSDC2 antibody (70R-1311)

Rabbit polyclonal CSDC2 antibody raised against the N terminal of CSDC2

Synonyms Polyclonal CSDC2 antibody, Anti-CSDC2 antibody, Cold Shock Domain Containing C2 Rna Binding antibody
Specificity CSDC2 antibody was raised against the N terminal of CSDC2
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen CSDC2 antibody was raised using the N terminal of CSDC2 corresponding to a region with amino acids MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP
Assay Information CSDC2 Blocking Peptide, catalog no. 33R-6562, is also available for use as a blocking control in assays to test for specificity of this CSDC2 antibody


Immunohistochemical staining using CSDC2 antibody (70R-1311)

CSDC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CSDC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.625 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using CSDC2 antibody (70R-1311) | CSDC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using CSDC2 antibody (70R-1311) | CSDC2 antibody (70R-1311) used at 0.625 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors