CSH2 antibody (70R-4526)

Rabbit polyclonal CSH2 antibody raised against the middle region of CSH2

Synonyms Polyclonal CSH2 antibody, Anti-CSH2 antibody, hCS-B antibody, CS-2 antibody, CSB antibody, Chorionic Somatomammotropin Hormone 2 antibody
Specificity CSH2 antibody was raised against the middle region of CSH2
Cross Reactivity Human
Applications WB
Immunogen CSH2 antibody was raised using the middle region of CSH2 corresponding to a region with amino acids LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH
Assay Information CSH2 Blocking Peptide, catalog no. 33R-4935, is also available for use as a blocking control in assays to test for specificity of this CSH2 antibody


Western Blot analysis using CSH2 antibody (70R-4526)

CSH2 antibody (70R-4526) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CSH2 antibody (70R-4526) | CSH2 antibody (70R-4526) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors