CSTF2T antibody (70R-4996)

Rabbit polyclonal CSTF2T antibody raised against the C terminal of CSTF2T

Synonyms Polyclonal CSTF2T antibody, Anti-CSTF2T antibody, Cleavage Stimulation Factor 3' Pre-Rna Subunit 2 64Kda Tau Variant antibody, KIAA0689 antibody, DKFZp434C1013 antibody, CstF-64T antibody
Specificity CSTF2T antibody was raised against the C terminal of CSTF2T
Cross Reactivity Human
Applications WB
Immunogen CSTF2T antibody was raised using the C terminal of CSTF2T corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT
Assay Information CSTF2T Blocking Peptide, catalog no. 33R-1203, is also available for use as a blocking control in assays to test for specificity of this CSTF2T antibody


Western Blot analysis using CSTF2T antibody (70R-4996)

CSTF2T antibody (70R-4996) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSTF2T antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSTF2T may play a significant role in AAUAAA-independent mRNA polyadenylation in germ cells. It is directly involved in the binding to pre-mRNAs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CSTF2T antibody (70R-4996) | CSTF2T antibody (70R-4996) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors