CTA-126B4.3 antibody (70R-4951)

Rabbit polyclonal CTA-126B4.3 antibody raised against the N terminal of CTA-126B4.3

Synonyms Polyclonal CTA-126B4.3 antibody, Anti-CTA-126B4.3 antibody, CTA-B4.3-126 antibody, MGC150423 antibody, Cgi-96 Protein antibody, CTA-126B4.3, CGI-96 antibody, CTA-B4.3 126 antibody, MGC150422 antibody, CTA-B4.3 126, CTA-B4.3-126, BK126B4.3 antibody
Specificity CTA-126B4.3 antibody was raised against the N terminal of CTA-126B4.3
Cross Reactivity Human
Applications WB
Immunogen CTA-126B4.3 antibody was raised using the N terminal of CTA-126B4.3 corresponding to a region with amino acids NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP
Assay Information CTA-126B4.3 Blocking Peptide, catalog no. 33R-6923, is also available for use as a blocking control in assays to test for specificity of this CTA-126B4.3 antibody


Western Blot analysis using CTA-126B4.3 antibody (70R-4951)

CTA-126B4.3 antibody (70R-4951) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CTA-126B4.3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CTA-126B4.3 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CTA-126B4.3 antibody (70R-4951) | CTA-126B4.3 antibody (70R-4951) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors