CUGBP1 antibody (70R-4862)

Rabbit polyclonal CUGBP1 antibody raised against the N terminal of CUGBP1

Synonyms Polyclonal CUGBP1 antibody, Anti-CUGBP1 antibody, hNab50 antibody, CUG-BP antibody, CUGBP antibody, NAB50 antibody, BRUNOL2 antibody, Cug Triplet Repeat Rna Binding Protein 1 antibody
Specificity CUGBP1 antibody was raised against the N terminal of CUGBP1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen CUGBP1 antibody was raised using the N terminal of CUGBP1 corresponding to a region with amino acids AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT
Assay Information CUGBP1 Blocking Peptide, catalog no. 33R-1032, is also available for use as a blocking control in assays to test for specificity of this CUGBP1 antibody


Immunohistochemical staining using CUGBP1 antibody (70R-4862)



Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CUGBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using CUGBP1 antibody (70R-4862) | Liver

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors