Cullin 5 antibody (70R-1629)

Rabbit polyclonal Cullin 5 antibody raised against the C terminal of CUL5

Synonyms Polyclonal Cullin 5 antibody, Anti-Cullin 5 antibody, CUL5 antibody
Specificity Cullin 5 antibody was raised against the C terminal of CUL5
Cross Reactivity Human, Mouse, Rat, Dog, ZebraFish
Applications WB
Immunogen Cullin 5 antibody was raised using the C terminal of CUL5 corresponding to a region with amino acids VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH
Assay Information Cullin 5 Blocking Peptide, catalog no. 33R-9706, is also available for use as a blocking control in assays to test for specificity of this Cullin 5 antibody


Western Blot analysis using Cullin 5 antibody (70R-1629)

Cullin 5 antibody (70R-1629) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CUL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Cullin 5 antibody (70R-1629) | Cullin 5 antibody (70R-1629) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors