CXORF34 antibody (70R-1205)

Rabbit polyclonal CXORF34 antibody raised against the middle region of Cxorf34

Synonyms Polyclonal CXORF34 antibody, Anti-CXORF34 antibody, Chromosome X Open Reading Frame 34 antibody, FLJ12687 antibody, dJ341D10.3 antibody
Specificity CXORF34 antibody was raised against the middle region of Cxorf34
Cross Reactivity Human
Applications WB
Immunogen CXORF34 antibody was raised using the middle region of Cxorf34 corresponding to a region with amino acids GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA
Assay Information CXORF34 Blocking Peptide, catalog no. 33R-3146, is also available for use as a blocking control in assays to test for specificity of this CXORF34 antibody


Western Blot analysis using CXORF34 antibody (70R-1205)

CXORF34 antibody (70R-1205) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CXORF34 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CXorf34 is a putative methyltransferase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CXORF34 antibody (70R-1205) | CXORF34 antibody (70R-1205) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors