CYB5D1 antibody (70R-3280)

Rabbit polyclonal CYB5D1 antibody raised against the middle region of CYB5D1

Synonyms Polyclonal CYB5D1 antibody, Anti-CYB5D1 antibody, FLJ32499 antibody, Cytochrome B5 Domain Containing 1 antibody
Specificity CYB5D1 antibody was raised against the middle region of CYB5D1
Cross Reactivity Human
Applications WB
Immunogen CYB5D1 antibody was raised using the middle region of CYB5D1 corresponding to a region with amino acids KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTEL
Assay Information CYB5D1 Blocking Peptide, catalog no. 33R-4736, is also available for use as a blocking control in assays to test for specificity of this CYB5D1 antibody

Images

Western Blot analysis using CYB5D1 antibody (70R-3280)

CYB5D1 antibody (70R-3280) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYB5D1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CYB protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYB5D1 antibody (70R-3280) | CYB5D1 antibody (70R-3280) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors