Cyclin D-Type Binding-Protein 1 antibody (70R-2392)

Rabbit polyclonal Cyclin D-Type Binding-Protein 1 antibody raised against the middle region of CCNDBP1

Synonyms Polyclonal Cyclin D-Type Binding-Protein 1 antibody, Anti-Cyclin D-Type Binding-Protein 1 antibody, Cyclin D-1 antibody, CCNDBP1 antibody, DIP1 antibody, Cyclin D 1, Cyclin D1, GCIP antibody, Cyclin D 1 antibody, Cyclin D-1
Specificity Cyclin D-Type Binding-Protein 1 antibody was raised against the middle region of CCNDBP1
Cross Reactivity Human
Applications WB
Immunogen Cyclin D-Type Binding-Protein 1 antibody was raised using the middle region of CCNDBP1 corresponding to a region with amino acids KNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSN
Assay Information Cyclin D-Type Binding-Protein 1 Blocking Peptide, catalog no. 33R-4575, is also available for use as a blocking control in assays to test for specificity of this Cyclin D-Type Binding-Protein 1 antibody

Images

Western Blot analysis using Cyclin D-Type Binding-Protein 1 antibody (70R-2392)

Cyclin D-Type Binding-Protein 1 antibody (70R-2392) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCNDBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Cyclin D-Type Binding-Protein 1 antibody (70R-2392) | Cyclin D-Type Binding-Protein 1 antibody (70R-2392) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £300.47
Size: 50 ug
OR
Shipping
View Our Distributors