Cyclin J antibody (70R-3737)

Rabbit polyclonal Cyclin J antibody raised against the N terminal of CCNJ

Synonyms Polyclonal Cyclin J antibody, Anti-Cyclin J antibody, bA690P14.1 antibody, CCNJ antibody
Specificity Cyclin J antibody was raised against the N terminal of CCNJ
Cross Reactivity Human
Applications WB
Immunogen Cyclin J antibody was raised using the N terminal of CCNJ corresponding to a region with amino acids FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL
Assay Information Cyclin J Blocking Peptide, catalog no. 33R-2996, is also available for use as a blocking control in assays to test for specificity of this Cyclin J antibody

Images

Western Blot analysis using Cyclin J antibody (70R-3737)

Cyclin J antibody (70R-3737) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCNJ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cyclin J may be involved in cell division and differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Cyclin J antibody (70R-3737) | Cyclin J antibody (70R-3737) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors