Cyclin N-Terminal Domain Containing 1 antibody (70R-4549)

Rabbit polyclonal Cyclin N-Terminal Domain Containing 1 antibody raised against the N terminal of CNTD1

Synonyms Polyclonal Cyclin N-Terminal Domain Containing 1 antibody, Anti-Cyclin N-Terminal Domain Containing 1 antibody, Cyclin N-Terminal Domain Containing -1, Cyclin N-Terminal Domain Containing 1, Cyclin N-Terminal Domain Containing -1 antibody, CNTD1 antibody, Cyclin N-Terminal Domain Containing 1 antibody, Cyclin N-Terminal Domain Containing 1, CNTD antibody, FLJ40137 antibody
Specificity Cyclin N-Terminal Domain Containing 1 antibody was raised against the N terminal of CNTD1
Cross Reactivity Human
Applications WB
Immunogen Cyclin N-Terminal Domain Containing 1 antibody was raised using the N terminal of CNTD1 corresponding to a region with amino acids QNEQAVREASGRLGRFREPQIVEFVFLLSEQWCLEKSVSYQAVEILERFM
Assay Information Cyclin N-Terminal Domain Containing 1 Blocking Peptide, catalog no. 33R-7660, is also available for use as a blocking control in assays to test for specificity of this Cyclin N-Terminal Domain Containing 1 antibody

Images

Western Blot analysis using Cyclin N-Terminal Domain Containing 1 antibody (70R-4549)

Cyclin N-Terminal Domain Containing 1 antibody (70R-4549) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CNTD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Cyclin N-Terminal Domain Containing 1 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Cyclin N-Terminal Domain Containing 1 antibody (70R-4549) | Cyclin N-Terminal Domain Containing 1 antibody (70R-4549) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors