Cyclin Y-Like 1 antibody (70R-5635)

Rabbit polyclonal Cyclin Y-Like 1 antibody raised against the N terminal of CCNYL1

Synonyms Polyclonal Cyclin Y-Like 1 antibody, Anti-Cyclin Y-Like 1 antibody, CCNYL1 antibody, FLJ40432 antibody
Specificity Cyclin Y-Like 1 antibody was raised against the N terminal of CCNYL1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Cyclin Y-Like 1 antibody was raised using the N terminal of CCNYL1 corresponding to a region with amino acids TVKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKF
Assay Information Cyclin Y-Like 1 Blocking Peptide, catalog no. 33R-9359, is also available for use as a blocking control in assays to test for specificity of this Cyclin Y-Like 1 antibody


Western Blot analysis using Cyclin Y-Like 1 antibody (70R-5635)

Cyclin Y-Like 1 antibody (70R-5635) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCNYL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of CCNYL1 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Cyclin Y-Like 1 antibody (70R-5635) | Cyclin Y-Like 1 antibody (70R-5635) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors